SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011614274.1.43450 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011614274.1.43450
Domain Number 1 Region: 7-203
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.8e-65
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000498
Further Details:      
 
Domain Number 2 Region: 187-323
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.93e-39
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011614274.1.43450
Sequence length 327
Comment pyruvate dehydrogenase subunit beta [Trichodesmium erythraeum]; AA=GCF_000014265.1; RF=representative genome; TAX=203124; STAX=1206; NAME=Trichodesmium erythraeum IMS101; strain=IMS101; AL=Complete Genome; RT=Major
Sequence
MAQTLLFNALRAAIDEEMAHDPTVYVLGEDVGHYGGSYKVTKGLYEKYGELRILDTPIAE
NSFTGMAIGSALTGLRPIIEGMNMGFLLLAFNQIANNAGMLRYTSGGNFKIPLVIRGPGG
VGRQLGAEHSQRLEAYFQAVPGLKIVACSTPYNAKGLLKSAIRDENPVLFFEHVLLYNLK
EDLPEDEYLLPLDKAEVVQTGKDVTILTYSRMRHHVTQAVQTLKKQGYDPEVIDLISLKP
LDFETIGASIKKTHRVIIVEECMKTGGIAAELIASINEKLFDELDAPILRLSSQDIPTPY
NGLLERLTIVQPEQIVEAVQKMVAIKV
Download sequence
Identical sequences Q10UU3
gi|113478393|ref|YP_724454.1| 203124.Tery_5078 WP_011614274.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]