SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011618060.1.57161 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011618060.1.57161
Domain Number 1 Region: 17-238
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 9.16e-52
Family PP-loop ATPase 0.00062
Further Details:      
 
Domain Number 2 Region: 246-297
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.00000144
Family MesJ substrate recognition domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011618060.1.57161
Sequence length 331
Comment tRNA lysidine(34) synthetase TilS [Synechococcus sp. CC9311]; AA=GCF_000014585.1; RF=na; TAX=64471; STAX=64471; NAME=Synechococcus sp. CC9311; strain=CC9311; AL=Complete Genome; RT=Major
Sequence
MAASKSWLPWHDTLHRQLLRQPNLLPDGETLLIALSGGQDSMALLGLLLGLQHLHHWHFQ
LWHGDHGWHDQSAATASELKEWCQGQELDLQISRNTRDHTGTEASARSWRYQELAALSQQ
FCCRTVLTAHTASDRAETLLLQLARGTDLAGLGSLRPIRPLQNNDPNGTRLVRPLLTFSR
DDTTQICQDLQLPVWLDPSNANPAFSRNRIRNDVLPVLEELHPGCSQRIAQLSERVSQVE
DSQRTLATLALEQLRYERGLHRKALKVLPDATRRLLLHHWLQQQGVRTLSASQLDTLSVA
IGPGRPPGSRSLAEHKTLQWTRDSVQLVSQP
Download sequence
Identical sequences Q0IE13
WP_011618060.1.57161 64471.sync_0071 gi|113953772|ref|YP_729309.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]