SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011618394.1.28265 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011618394.1.28265
Domain Number 1 Region: 112-209
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 7.59e-38
Family Ribosomal protein S3 C-terminal domain 0.0000165
Further Details:      
 
Domain Number 2 Region: 2-109
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 2.88e-32
Family Prokaryotic type KH domain (KH-domain type II) 0.0000944
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011618394.1.28265
Sequence length 243
Comment MULTISPECIES: 30S ribosomal protein S3 [Synechococcus]; AA=GCF_001040845.1; RF=na; TAX=32052; STAX=32052; NAME=Synechococcus sp. WH 8020; strain=WH 8020; AL=Chromosome; RT=Major
Sequence
MGHKIHPTGLRLGITQEHRSRWYASSKSYPALLQEDDRIRKFIHKKYGSAGISDVLIARK
ADQLEVELKTARPGVLVGRQGSGIEDLRSGIQKTVGDSSRQVRINVVEVERVDADAFLLA
EYIAQQLEKRVAFRRTIRMAVQRAQRAGVLGLKIQVSGRLNGAEIARTEWTREGRVPLHT
LRAEIDYATKVASTTYGVLGIKVWVFKGEVLSDDSQQQIPVGANPRRRAGRRPQQFEDRS
NEG
Download sequence
Identical sequences A0A0H4BF91 Q0ID11
64471.sync_0431 WP_011618394.1.28265 WP_011618394.1.57161 gi|113955322|ref|YP_729661.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]