SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011618839.1.28265 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011618839.1.28265
Domain Number 1 Region: 80-158
Classification Level Classification E-value
Superfamily ACT-like 6.41e-25
Family IlvH-like 0.0025
Further Details:      
 
Domain Number 2 Region: 1-75
Classification Level Classification E-value
Superfamily ACT-like 1.63e-21
Family IlvH-like 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011618839.1.28265
Sequence length 176
Comment MULTISPECIES: acetolactate synthase small subunit [Synechococcus]; AA=GCF_001040845.1; RF=na; TAX=32052; STAX=32052; NAME=Synechococcus sp. WH 8020; strain=WH 8020; AL=Chromosome; RT=Major
Sequence
MKHTLSVLVEDESGALSRIAGLFARRGFNIDSLAVGPAETNGQSRLTMVVEGDEHTLQQM
SKQLDKLVNVLQVLDLSQLPAVERELMLMKVSAPAEQRSAILELVQVFRAKVVDVADDAL
TLEVVGDPGKLVALERLMAPYGILEIARTGKVALERASGVNTELLKAAISGGRVPA
Download sequence
Identical sequences A0A0H4B5B1 Q0IBQ9
WP_011618839.1.28265 WP_011618839.1.57161 64471.sync_0900 gi|113955111|ref|YP_730113.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]