SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011620278.1.57161 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011620278.1.57161
Domain Number 1 Region: 8-146
Classification Level Classification E-value
Superfamily Transcription factor NusA, N-terminal domain 5.89e-27
Family Transcription factor NusA, N-terminal domain 0.00074
Further Details:      
 
Domain Number 2 Region: 229-310
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 1.37e-23
Family Prokaryotic type KH domain (KH-domain type II) 0.00017
Further Details:      
 
Domain Number 3 Region: 312-376
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 4.32e-16
Family Prokaryotic type KH domain (KH-domain type II) 0.00017
Further Details:      
 
Domain Number 4 Region: 152-225
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000146
Family Cold shock DNA-binding domain-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011620278.1.57161
Sequence length 501
Comment transcription termination factor NusA [Synechococcus sp. CC9311]; AA=GCF_000014585.1; RF=na; TAX=64471; STAX=64471; NAME=Synechococcus sp. CC9311; strain=CC9311; AL=Complete Genome; RT=Major
Sequence
MALVLLPGLSNLIEDISEEKKLAPQVVEAALREALLKGYERYRRTLYLGISEDPFDEEYF
SNFDVALDLDEEGYRVLASKIIVDEVESEDHQIALAEVMQVAEDAQAGDTVVLDVTPEKE
DFGRMAAATTKQVLAQKLRDQQRRMIQEEFADLEDPVLTARVIRFERQSIIMAVSSGLGR
PEVEAELPRRDQLPNDNYRANATFKVFLKEVSEVPRRGPQLFVSRANAGLVVYLFENEVP
EIQEGSVRIVAVAREANPPSRAVGPRTKVAVDSIEREVDPVGACIGARGSRIQQVVNELR
GEKIDVIRWSQDPSQYIANSLSPARVEVVRLVDPEGQHAHVLVPPDQLSLAIGREGQNVR
LAARLTGWKIDIKNSTEYDQTAEDAVVSELISQREEEEALQREAEERLAIEQAARAEEDA
RLRELYPLPEDEEGYTEDGEYYEDAEAAGEEPVAEAVEESVETADTELQAEDQATEHTEQ
QEDELDSEDAPNTSDVEEGAR
Download sequence
Identical sequences Q0I7K4
gi|113954345|ref|YP_731568.1| WP_011620278.1.57161 64471.sync_2371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]