SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011621120.1.3791 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011621120.1.3791
Domain Number 1 Region: 34-105
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.0000764
Family Coronavirus S2 glycoprotein 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011621120.1.3791
Sequence length 217
Comment DNA repair ATPase [Shewanella sp. MR-4]; AA=GCF_000014685.1; RF=na; TAX=60480; STAX=60480; NAME=Shewanella sp. MR-4; strain=MR-4; AL=Complete Genome; RT=Major
Sequence
MKRLITSSLMAATLLLTGCQSAYYGAMEKVGYHKRDIMVDRVKAAKESQEDAQKEFSSAL
EEMQALLNHDGGNLEKAYNKAKDEYESAQSAADDVSNRINKVEDVAEALFDEWQAEISEI
SKASLRRNSETKLKETRRSYQQLMKTMRRAESKMPPILTAMKDNMLYLKHNLNAQAIGAI
KGEFASLQTDISGLIKEMNKSINESTKFIEALENSKG
Download sequence
Identical sequences gi|113968658|ref|YP_732451.1| 60480.Shewmr4_0314 WP_011621120.1.3791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]