SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011621709.1.3791 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011621709.1.3791
Domain Number 1 Region: 4-135
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.7e-22
Family SMI1/KNR4-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011621709.1.3791
Sequence length 141
Comment SMI1/KNR4 family protein [Shewanella sp. MR-4]; AA=GCF_000014685.1; RF=na; TAX=60480; STAX=60480; NAME=Shewanella sp. MR-4; strain=MR-4; AL=Complete Genome; RT=Major
Sequence
MSNYRDKFEYPESPATPEDVELLEKWLGNNLPSEYKIFLLETNGAETPIGVQEPDDSIVL
WSAREVSELTEAYCYEQYLPGLIAIGSDGGGESIVFDTTHSKSSEEWPLYRVPFADLTKE
AMVLLAVSFKDWVTNGYTLKF
Download sequence
Identical sequences 60480.Shewmr4_0915 WP_011621709.1.3791 gi|113969259|ref|YP_733052.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]