SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011636723.1.15765 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011636723.1.15765
Domain Number 1 Region: 60-178
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000053
Family SMI1/KNR4-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011636723.1.15765
Sequence length 216
Comment protein Syd [Shewanella frigidimarina]; AA=GCF_000014705.1; RF=representative genome; TAX=318167; STAX=56812; NAME=Shewanella frigidimarina NCIMB 400; strain=NCIMB 400; AL=Complete Genome; RT=Major
Sequence
MSCSSALDCFIKNYLKSYQDTLSEFPRYYPLGEDSICIQGTFNADTDDTVFWQPVKRDNV
ADFSNVEHALNIQLHQDIHAFYGQYFSAPLPFTASFGDGELLQAWNQDDFENLQQNVIGH
LIMKKKLKQPATWFIGVLGEGDEMLTVNNDDGSVWIEIPGEKQRTKLAESLTEFLESLSP
MIKPPSKPVEELPHTVDHPGIWQRIKTMWDYLLRKK
Download sequence
Identical sequences A0A2I0H809 Q085G3
318167.Sfri_1249 WP_011636723.1.15765 gi|114562427|ref|YP_749940.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]