SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011637326.1.45693 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011637326.1.45693
Domain Number 1 Region: 4-153
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.03e-41
Family Glutathione peroxidase-like 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011637326.1.45693
Sequence length 155
Comment peroxiredoxin [Shewanella frigidimarina]; AA=GCF_001529365.1; RF=na; TAX=56812; STAX=56812; NAME=Shewanella frigidimarina; strain=Ag06-30; AL=Contig; RT=Major
Sequence
MNTLNVGDTAPNFTLQNQAGEAVSLQDTLSKGPVLVYFYPKASTPGCTVQAQGLRDIKAQ
LDGLHVTVFGISPDPVAKLAKFADKQQLNFALLSDEDHAVADGFGVWGQKKFMGKIYDGI
HRLSFIVGTDGKISHVLNKFKTKDHHEVVLATLAE
Download sequence
Identical sequences A0A106BZ89 A0A2I0H9I8 Q082V5
WP_011637326.1.15765 WP_011637326.1.45693 gi|114563035|ref|YP_750548.1| 318167.Sfri_1862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]