SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011655189.1.100861 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011655189.1.100861
Domain Number 1 Region: 3-182
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-27
Family Beta-D-xylosidase C-terminal domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011655189.1.100861
Sequence length 194
Comment regulation of enolase 1 [Rhizobium leguminosarum]; AA=GCF_000427765.1; RF=na; TAX=1041145; STAX=384; NAME=Rhizobium leguminosarum bv. viciae VF39; strain=VF39; AL=Scaffold; RT=Major
Sequence
MSIDFNDGKWLNEPAHWQATETGLILTTDEKTDFWRETHYGFTRDSGHFLAFPTTDSFTA
QIRVRGEFRTLYDQAGLMVRIDERRWVKTGVEFTDGEAYLSTVVTDGKSDWSVAQPFREL
EDFRIRVTVANGAMRIQASRDGSFWPLLRLAPFPAADHYEVGPTACTPERSGLTVRFCEF
SIGPAITTDLHDLS
Download sequence
Identical sequences Q1M5T3
216596.pRL110453 gi|116255654|ref|YP_771487.1|NC_008384 WP_011655189.1.100861 WP_011655189.1.53928 gi|116255654|ref|YP_771487.1| RlR239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]