SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011655189.1.53928 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011655189.1.53928
Domain Number 1 Region: 3-182
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-27
Family Beta-D-xylosidase C-terminal domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011655189.1.53928
Sequence length 194
Comment regulation of enolase 1 [Rhizobium leguminosarum]; AA=GCF_000009265.1; RF=na; TAX=216596; STAX=384; NAME=Rhizobium leguminosarum bv. viciae 3841; strain=3841; AL=Complete Genome; RT=Major
Sequence
MSIDFNDGKWLNEPAHWQATETGLILTTDEKTDFWRETHYGFTRDSGHFLAFPTTDSFTA
QIRVRGEFRTLYDQAGLMVRIDERRWVKTGVEFTDGEAYLSTVVTDGKSDWSVAQPFREL
EDFRIRVTVANGAMRIQASRDGSFWPLLRLAPFPAADHYEVGPTACTPERSGLTVRFCEF
SIGPAITTDLHDLS
Download sequence
Identical sequences Q1M5T3
gi|116255654|ref|YP_771487.1|NC_008384 RlR239 WP_011655189.1.100861 WP_011655189.1.53928 gi|116255654|ref|YP_771487.1| 216596.pRL110453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]