SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011673585.1.97541 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011673585.1.97541
Domain Number 1 Region: 323-470
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.46e-28
Family HD domain 0.017
Further Details:      
 
Domain Number 2 Region: 207-303
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.66e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011673585.1.97541
Sequence length 519
Comment ribonuclease Y 1 [Pediococcus pentosaceus]; AA=GCF_000285875.1; RF=na; TAX=1133596; STAX=1255; NAME=Pediococcus pentosaceus IE-3; strain=IE-3; AL=Contig; RT=Major
Sequence
MIILYIILAIIAIVVGYCAGFFMHKRLIEKQTANASNSADVIVENARKQAETERREKLLE
AKDESHRYRAKVEKELKERRAELQKQEDRLLQREDSLDRKDNSFEKRENSLERKEQKLAL
DQKHIDEQQQKASSLVEERQQELERVSNLTQEDAKNLIISETEAKLEKERALIIKEGLED
AEAEADQTARKLIAEAIQRSAADMASETTITVVSLPNDDMKGRIIGREGRNIRNFQNVTG
VDLIIDDTPEAVVLSSFDPIRREIARIALDKLIQDGRIHPARIEEMVEKAKKEMDDNIRK
TGEQAVFDLGIHSMNPELIKLIGQLKYRTSYGQNVLNHSIEVANLAGVLAAELGEDVTVA
KRAGLLHDIGKAVQHETDTSHAQLGVELAKKYKESATVINAIAAHHDGVEAQHVISVLVA
AANSISAARPGARSDTLQSYIHRLEKLEQISNNFDGVKKSYAIQAGREVRVIVKPNKIND
LKAVMLTHNIRKAIEKELEYAGKVKVTVVREVRAVDYAK
Download sequence
Identical sequences A0A1Y0VTD2 Q03EQ6
PtR38 278197.PEPE_1275 WP_011673585.1.1876 WP_011673585.1.35559 WP_011673585.1.46652 WP_011673585.1.5834 WP_011673585.1.66730 WP_011673585.1.67299 WP_011673585.1.97541 gi|116493023|ref|YP_804758.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]