SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011676969.1.101083 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011676969.1.101083
Domain Number 1 Region: 336-474
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.46e-27
Family HD domain 0.027
Further Details:      
 
Domain Number 2 Region: 219-315
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.95e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011676969.1.101083
Sequence length 531
Comment ribonuclease Y [Lactococcus lactis]; AA=GCF_000014545.1; RF=na; TAX=272622; STAX=1358; NAME=Lactococcus lactis subsp. cremoris SK11; strain=SK11; AL=Complete Genome; RT=Major
Sequence
MDIISIVLLVLLVVLVVAFIFCAQNIKKNKQDAESLFNEAENKANEVMASAKREAESLKR
EAEAFKKEARYTLREEEQKQRREIEDEFKQERQELKETEKRLKQREEILDRKDDTLTKKE
ENLDSKEENLVRKTDTLSKREEQLAHIEEKKRLELERISNLSMDDAREIILSETRDGLTK
EMAQTIRQSEEKAQAEADKRAKNIISLAIQRVSSDSVAEQTVSVVNLPDDGMKGRIIGRE
GRNIRTFEALTGIDVIIDDTPEAVVLSGFDPIRREIARMTLEQLVQDGRIHPARIEELVE
KNRKALDHKMREYGEQAAFEVGAHNLHPDLMKIMGRLHFRTSYGQNVLDHSVEVAHIAGN
LAGEMGENEALAKRAGFLHDIGKALDHEVEGSHVEIGTELARKYKENPIVINTIASHHGD
TEPLSNIAVLVAAADALSAARPGARRESIENYIKRLKDLEAISTSFDGVETAFALQAGRE
IRVMVKPDKLTDDQIVILARDVKNRIEDEMDYPGNIKVTVIRETRAIDYAK
Download sequence
Identical sequences A0A1V0PBT8 Q02WP0
272622.LACR_2159 gi|116512838|ref|YP_811745.1| WP_011676969.1.101083 WP_011676969.1.38190 WP_011676969.1.63588 WP_011676969.1.86027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]