SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011707071.1.67280 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011707071.1.67280
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.37e-50
Family Ribonuclease PH domain 1-like 0.0000163
Further Details:      
 
Domain Number 2 Region: 292-487
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.09e-47
Family Ribonuclease PH domain 1-like 0.0000157
Further Details:      
 
Domain Number 3 Region: 144-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.49e-29
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 
Domain Number 4 Region: 449-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.94e-28
Family Ribonuclease PH domain 2-like 0.0000729
Further Details:      
 
Domain Number 5 Region: 553-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.74e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 
Domain Number 6 Region: 619-694
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.51e-21
Family Cold shock DNA-binding domain-like 0.00014
Further Details:      
 
Domain Number 7 Region: 237-319
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 2.51e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011707071.1.67280
Sequence length 712
Comment MULTISPECIES: polyribonucleotide nucleotidyltransferase [Aeromonas]; AA=GCF_000724965.1; RF=na; TAX=644; STAX=644; NAME=Aeromonas hydrophila; strain=RB-AH; AL=Contig; RT=Major
Sequence
MNPIVKSFQYGQHTVTLETGVMARQATAAVMVSMDDTCVFVTVVGKKEADHGRDFFPLTV
NYQERTYAAGRIPGGFFRREGRPSEGETLISRLIDRPIRPLFPEGFLNEVQVVATVMSVN
PAVSPDIVAMIGASAALAISGIPFGGPIGAARVGYMNGQYVLNPTTTELPQSDLDLVVAG
TANAVLMVESEAAILSEEVMLGAVVFGHEQMQAVINAINEFAADVGTKPWNWTAPAVNEA
LKAKVAELATAELGEAYRITEKAVRYETIGAIKARVVEQVIASGVEEDAKKIGEEFHSLE
SRIVRGRVVRGEPRIDGRDPEMIRALSVATGVLPRAHGSALFTRGETQAMVVATLGTERD
AQNIDELTGNRADRFMLHYNFPPYCVGETGMMGSPKRREIGHGRLAKRGVAAVMPSADEF
PYVVRVVSEITESNGSSSMASVCGSSLALMDAGVPIKASVAGIAMGLVKEEEGFVVLSDI
LGDEDHLGDMDFKVAGTTEGVTALQMDIKIEGITKEIMEIALKQARGARLHILKVMDEAI
QAPRAEISDFAPRIHTIKINPEKIKDVIGKGGSVIRALTEETGTNIELDDDGTVRIAAVD
GDAAKEAIRRIEAITAEIEVNRIYEGKVVRLADFGAFVNILPGKDGLVHISQITDARVQN
VADYLKIGDVVKVKVLEVDRQGRVRLSIKEANAPTEAAAEPAVAAVEEPAAE
Download sequence
Identical sequences A0A1C2L3G5 A0A1N6RGT5 A0KND9
380703.AHA_3299 WP_011707071.1.12787 WP_011707071.1.13401 WP_011707071.1.28436 WP_011707071.1.34034 WP_011707071.1.34829 WP_011707071.1.38175 WP_011707071.1.41987 WP_011707071.1.56470 WP_011707071.1.61841 WP_011707071.1.62309 WP_011707071.1.64954 WP_011707071.1.66799 WP_011707071.1.67280 WP_011707071.1.85013 WP_011707071.1.93930 YP_857790.1.44769 gi|117618225|ref|YP_857790.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]