SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011719990.1.7777 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011719990.1.7777
Domain Number 1 Region: 80-139
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000144
Family NfeD domain-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011719990.1.7777
Sequence length 143
Comment hypothetical protein [Acidothermus cellulolyticus]; AA=GCF_000015025.1; RF=representative genome; TAX=351607; STAX=28049; NAME=Acidothermus cellulolyticus 11B; strain=11B; ATCC 43068; AL=Complete Genome; RT=Major
Sequence
MPMWLIWTIVAVACAGAEALTLTLILGFIAAAAALTLVAAVLGAPIVAQLLVFVGSAAAL
LGVVRPIARAHLYTPPALRTGVDALVGQRGLVVERVDAHHGQIKIGGELWSARPYVDGQC
YEPGTTVEVVKIQGAIALVFGTE
Download sequence
Identical sequences A0LU17
gi|117928362|ref|YP_872913.1| 351607.Acel_1155 WP_011719990.1.7777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]