SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011749274.1.25907 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011749274.1.25907
Domain Number 1 Region: 16-279
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.29e-48
Family Atu1826-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011749274.1.25907
Sequence length 282
Comment MULTISPECIES: peptidase S15 [Paracoccus]; AA=GCF_900100045.1; RF=na; TAX=266; STAX=266; NAME=Paracoccus denitrificans; strain=DSM 413; AL=Scaffold; RT=Major
Sequence
MRKGLSASAVLALLAFPAHGETLTLTLDRGIAATLEMPAGHGRFPAVLMFHGLGSSRDEV
GIIFADTATALAMDGIASLRIDFRGFGKSDGDTGAFTLERQNEDAAIALQALAAMDKIDA
ERIGLMGFSFGAGAAIELAAAQPETIKSLVVWAPVGNYHDDMLDSLGQRAFDLAERDGIV
GLDLGWRTMALKRDFFDGLNRHDLLAALRAYDAPFMVVNGSDDPYRKYTPALMQAAAGAE
KRALVIEGGDHVFHVYTPSRSLAPEVIEATVERFRDTLGKTR
Download sequence
Identical sequences A1B6E3 O54025
318586.Pden_3004 gi|119385728|ref|YP_916783.1| WP_011749274.1.12501 WP_011749274.1.25907 WP_011749274.1.28967 WP_011749274.1.3707 WP_011749274.1.52749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]