SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011749472.1.25907 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011749472.1.25907
Domain Number 1 Region: 3-74
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000215
Family GntR-like transcriptional regulators 0.044
Further Details:      
 
Domain Number 2 Region: 99-217
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.000000000131
Family GntR ligand-binding domain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011749472.1.25907
Sequence length 236
Comment regulatory protein GntR [Paracoccus denitrificans]; AA=GCF_900100045.1; RF=na; TAX=266; STAX=266; NAME=Paracoccus denitrificans; strain=DSM 413; AL=Scaffold; RT=Major
Sequence
MPRSKSEYVAQRLLDRIITDNLASGSYLGTEAELLQQFNVSRPTLRESLRILETQGVIEL
RPGPGGGIMITRPGTDIVAHGLSVYLRVHGIPDTTMHRALIALQPALIAQAAEMGSADDF
DALDAVVEKMRLTSDLRELRQELRHFYLLIARATQNQILDIFWSTLDKLSGGPASTLEGE
KITAAGRQRIVALHGEMVSACRAKDPSTASALLNALLSAPSPSQTQSRRRQARSEA
Download sequence
Identical sequences A1B6Z3
WP_011749472.1.25907 WP_011749472.1.3707 WP_011749472.1.52749 gi|119385928|ref|YP_916983.1| 318586.Pden_3206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]