SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011749640.1.3707 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011749640.1.3707
Domain Number 1 Region: 83-215
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 8.63e-22
Family GntR ligand-binding domain-like 0.028
Further Details:      
 
Domain Number 2 Region: 8-97
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.25e-20
Family GntR-like transcriptional regulators 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011749640.1.3707
Sequence length 223
Comment MULTISPECIES: GntR family transcriptional regulator [Paracoccus]; AA=GCF_900115985.1; RF=na; TAX=266; STAX=266; NAME=Paracoccus denitrificans; strain=DSM 415; AL=Scaffold; RT=Major
Sequence
MDIEKQWPRGQRAAFVANFIRDQIVSGELAASTRINERVLTEQLGVSRTPLREAFKILES
EGLLTIEPNRGAMVTAISPQEVELAIEVLIALESVAAERACKHATDAQIDEIQALHDEMV
GAWKAGALMRYFHINQTIHQKIVDCAANPTLSRLYMAESQRIRRFRYAGNQISDRWARAV
YEHEQILDALRHRQGALLREVLRSHHLSGWRTTRAVLEGEIRL
Download sequence
Identical sequences A0A1I5KBM7 A1B7G8
gi|119386103|ref|YP_917158.1| 318586.Pden_3389 WP_011749640.1.25907 WP_011749640.1.28967 WP_011749640.1.3707 WP_011749640.1.52621 WP_011749640.1.52749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]