SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011815226.1.1857 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011815226.1.1857
Domain Number - Region: 21-49
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0288
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011815226.1.1857
Sequence length 61
Comment MULTISPECIES: hypothetical protein [Campylobacter]; AA=GCF_001228905.1; RF=na; TAX=195; STAX=195; NAME=Campylobacter coli; strain=OXC6296; AL=Scaffold; RT=Major
Sequence
MENKNFKKTIDLNVIIPKFLNSLNSIILNKVNQKLKFLNFYFKKLQTESVANRNRNYDIM
F
Download sequence
Identical sequences A0A0H3PCB4
WP_011815226.1.100358 WP_011815226.1.1256 WP_011815226.1.1376 WP_011815226.1.1857 WP_011815226.1.208 WP_011815226.1.24558 WP_011815226.1.26708 WP_011815226.1.27710 WP_011815226.1.33997 WP_011815226.1.35427 WP_011815226.1.35646 WP_011815226.1.35955 WP_011815226.1.41028 WP_011815226.1.41840 WP_011815226.1.45391 WP_011815226.1.48021 WP_011815226.1.49088 WP_011815226.1.56397 WP_011815226.1.63528 WP_011815226.1.66067 WP_011815226.1.79113 WP_011815226.1.80259 WP_011815226.1.85042 WP_011815226.1.85419 WP_011815226.1.87304 WP_011815226.1.87957 gi|121999271|ref|YP_001004024.1| 354242.CJJ81176_pTet0020 gi|121999271|ref|YP_001004024.1|NC_008790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]