SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011819538.1.83733 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011819538.1.83733
Domain Number 1 Region: 29-358
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.58e-63
Family AAT-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011819538.1.83733
Sequence length 369
Comment histidinol-phosphate aminotransferase [Prochlorococcus marinus]; AA=GCF_000015665.1; RF=representative genome; TAX=167542; STAX=1219; NAME=Prochlorococcus marinus str. MIT 9515; strain=MIT 9515; AL=Complete Genome; RT=Major
Sequence
MSEFNKINNLPPTPRKEIINMQSYSAPLENRRNLLRLDFNENTLGPSQKVYEAIKDIKLN
QISIYPEYNLLKNFLSHNYYESRQFDSEEIGLFNGADAVINAIFHSFGDRDEIFLTTNPT
FGYYSPCSEIQGMKKITCSYEGEHFLFPIKRFEEKIIKHKPKLIFICNPNNPTGTVLSAQ
EIIKLANLNKSSLIVVDELYEKFNGDSLLPKIDFQEIKNIVIIQSLSKTAGLAGLRIGFA
FGNKSIIQYINKVTGPYDVNSFAVTAALAALNDKSYIDNYVTEVNKARLFIEKKFESLSI
RTHFGAGNYFLIWPNQNPEILTRKMRERGILIREMKNKKDIENSVRVSIGTQEQMLRFWS
TYKELDLNN
Download sequence
Identical sequences A2BUG3
167542.P9515_02151 WP_011819538.1.83733 gi|123965450|ref|YP_001010531.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]