SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011820750.1.83733 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011820750.1.83733
Domain Number 1 Region: 1-84
Classification Level Classification E-value
Superfamily Ribosomal protein S16 7.72e-26
Family Ribosomal protein S16 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011820750.1.83733
Sequence length 114
Comment 30S ribosomal protein S16 [Prochlorococcus marinus]; AA=GCF_000015665.1; RF=representative genome; TAX=167542; STAX=1219; NAME=Prochlorococcus marinus str. MIT 9515; strain=MIT 9515; AL=Complete Genome; RT=Major
Sequence
MIKLRLKRFGKKKEASFRIVACNSTSRRDGRPLQELGFYNPRTKETRLDTEALRIRLTQG
AQPTDVVRTLLEKGGLLEKKVRPSIAIGKANLEKEKIAKAKSKESESANKEAES
Download sequence
Identical sequences A2BXZ2
gi|123966679|ref|YP_001011760.1| WP_011820750.1.83733 167542.P9515_14461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]