SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011821318.1.50451 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011821318.1.50451
Domain Number 1 Region: 16-202,327-408
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.43e-54
Family Bacterial dinuclear zinc exopeptidases 0.0019
Further Details:      
 
Domain Number 2 Region: 205-319
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 3.89e-19
Family Bacterial exopeptidase dimerisation domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011821318.1.50451
Sequence length 409
Comment diaminopimelate aminotransferase [Hyperthermus butylicus]; AA=GCF_000015145.1; RF=representative genome; TAX=415426; STAX=54248; NAME=Hyperthermus butylicus DSM 5456; strain=DSM 5456; AL=Complete Genome; RT=Major
Sequence
MRVLDETDARTLHSYIIDLYKSFIPVKAIPPDMGGEGELERAKVLEDELRRLGLRVWRVD
ARDERARGGIRPNILAQLEGADTSRTLWIVAHMDTVPEGDRSLWRYEPYSVTVEDDYVYG
RGVEDNGQAIVVAFAVAKYLVERGVKPRVNLGIALVSDEETGSRYGLQYLLSQNVFGTPE
SNWFLVPDAGSPDGSKVIVAEKHILWFKIRVVGMQAHASTPHEGINAHRLGMMFNLELDR
ILHTRFTRYDPIFEPPVSTFEPTRKEENVSNINTIPGVDTVYWDARILPSYSIDEVVETV
KSTAYSFASSHGIKVEVEIVARDDAGEPTSPDHPFTRAFLRAIREARNVEPKLLGIGGGT
IARYLRKKGYPALVWMTCEETAHKPNERARLSSILADVDTVLYYLLHVA
Download sequence
Identical sequences A2BJ40
415426.Hbut_0126 gi|124027026|ref|YP_001012346.1| WP_011821318.1.50451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]