SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011821432.1.50451 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011821432.1.50451
Domain Number - Region: 424-462
Classification Level Classification E-value
Superfamily Prefoldin 0.00207
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011821432.1.50451
Sequence length 473
Comment hypothetical protein [Hyperthermus butylicus]; AA=GCF_000015145.1; RF=representative genome; TAX=415426; STAX=54248; NAME=Hyperthermus butylicus DSM 5456; strain=DSM 5456; AL=Complete Genome; RT=Major
Sequence
MAAYWFTAGLAALNYAYRLLGRRRLVAYIVAAAAMLAVALGLASLYAPVAASRHVEVMSL
DEPIDVNGLKCFIPLMTAYAYASGRIQIPTHRVYSEDSYVYYLGNHSVYNWIIEPEGFWN
HLTKKPLGVVFVYGDEYPPHVEVVEKPLEWGLHSKVFRLLFFDTLERRIVLAAGLRYKPL
LEDNIEILHEERIYILVPLVTWKRGLLYSIPILYGYAVVDEDGGIEVVEKDRLASDPRFQ
GMPLLPEAIARSWVEAYRYRVGLIEFYLHHNTYVIRDIGTNPQPYLEQGADSRLYWVFVA
EPPGETYSTRYIIYVEASHVEGLQLLFYEFPEPVIGISKVESYIKQAHPIYDWGELSIEE
PMLTMLNGTLYWKATVTTKDYRGLVAVDIVNAATSEITSLQPRRHITYLDALQAILGHMA
IEEHPAKSLEERINTLEHRIAEVIKTLEEIQQELQELQRMVSNTTASTGEPPR
Download sequence
Identical sequences A2BJF4
gi|124027140|ref|YP_001012460.1| WP_011821432.1.50451 415426.Hbut_0243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]