SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011821674.1.50451 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011821674.1.50451
Domain Number 1 Region: 170-487
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.88e-112
Family Leucine aminopeptidase, C-terminal domain 0.000000205
Further Details:      
 
Domain Number 2 Region: 30-175
Classification Level Classification E-value
Superfamily Macro domain-like 0.00000000000306
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011821674.1.50451
Sequence length 490
Comment leucyl aminopeptidase [Hyperthermus butylicus]; AA=GCF_000015145.1; RF=representative genome; TAX=415426; STAX=54248; NAME=Hyperthermus butylicus DSM 5456; strain=DSM 5456; AL=Complete Genome; RT=Major
Sequence
MSTLLRVGNARNGVDAIAYVAGEKQLEWLKGFGDTVRTVIELGDFKGKLEETILIYESSA
TVKRVILAGAGGNEWFGDAERLRVAVASAVKLARSKKSIKRLGVVVHEELLEKAAETAGR
DTVWSVEQALVAADMANYVYSLREREEKPHILEEVRLEPGDEKAVETAKAIAEAVRVARD
IANAPANRLSPEKLEEKARELASRLGLTIRVLYRSDLESLGMGGILAVGSGSNVEPRLII
LEYNSGGKRIAVVGKAVVFDAGGLDLKPPQAMQEMKFDKSGGAAAIGAVVAAALLRLPVN
MVALVPAVENLPSGRAYKPLDVIRMYNGTTVEIGNTDAEGRLIMADALAYAAEKYKPDYM
FDFATLTGAAVVALGNHAAALFSNNDQLASMVERAAWIAGEPVWKMPLWPVYAKQLESHV
ADTNNVGGRPAGAITAAKFLEKFVGDRPWAHLDIAGTAWVQEKGPWKPYYEKGATGWGVR
TLVEFLRLLI
Download sequence
Identical sequences A2BK45
gi|124027381|ref|YP_001012701.1| WP_011821674.1.50451 415426.Hbut_0494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]