SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011821775.1.50451 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011821775.1.50451
Domain Number 1 Region: 18-62
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000759
Family beta-sandwich domain of Sec23/24 0.038
Further Details:      
 
Weak hits

Sequence:  WP_011821775.1.50451
Domain Number - Region: 63-103
Classification Level Classification E-value
Superfamily Prefoldin 0.000379
Family Prefoldin 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011821775.1.50451
Sequence length 110
Comment hypothetical protein [Hyperthermus butylicus]; AA=GCF_000015145.1; RF=representative genome; TAX=415426; STAX=54248; NAME=Hyperthermus butylicus DSM 5456; strain=DSM 5456; AL=Complete Genome; RT=Major
Sequence
MFGYWYRWMRRLVYYAPPPPPPPPLPLQQQQSQQQQYPYQYPPYPYYPPIPPYPYYMPPI
PQSPEEELEMLEEYKKMLEEDLKELQEELKSVEERIRELREIIRHRSSKA
Download sequence
Identical sequences A2BKE6
gi|124027482|ref|YP_001012802.1| WP_011821775.1.50451 415426.Hbut_0598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]