SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011833852.1.86236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011833852.1.86236
Domain Number 1 Region: 55-100
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 0.0000785
Family Zn-finger domain of Sec23/24 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011833852.1.86236
Sequence length 106
Comment ribonuclease P [Methanocorpusculum labreanum]; AA=GCF_000015765.1; RF=representative genome; TAX=410358; STAX=83984; NAME=Methanocorpusculum labreanum Z; strain=Z; AL=Complete Genome; RT=Major
Sequence
MAKAEKGVSAKKIAQERVDILFERAKEARDEPELSARYVSLAREMAMKQRVRLAHYHRRS
FCPSCHAYFIPGTNLRVRIQHGKIIYTCGICGAVTRIPLNKKTESR
Download sequence
Identical sequences A2STJ3
gi|124486300|ref|YP_001030916.1| 410358.Mlab_1485 WP_011833852.1.86236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]