SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011837902.1.31213 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011837902.1.31213
Domain Number 1 Region: 119-487
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.34e-114
Family Amylase, catalytic domain 0.00000000744
Further Details:      
 
Domain Number 2 Region: 1-117
Classification Level Classification E-value
Superfamily E set domains 3.08e-33
Family E-set domains of sugar-utilizing enzymes 0.00054
Further Details:      
 
Weak hits

Sequence:  WP_011837902.1.31213
Domain Number - Region: 492-570
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00105
Family alpha-Amylases, C-terminal beta-sheet domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011837902.1.31213
Sequence length 575
Comment alpha-glycosidase [Ruminiclostridium thermocellum]; AA=GCF_000015865.1; RF=representative genome; TAX=203119; STAX=1515; NAME=Ruminiclostridium thermocellum ATCC 27405; strain=ATCC 27405; AL=Complete Genome; RT=Major
Sequence
MKLEAIYHKPYSEFAFPVAPDTLVIRLRTAKNDVNTCILIYHEKYDTSQRGKVKMDKVAS
DGMFDYYEVELNVGIKRIKYMFYLEDNYSIKWYSSDGFFDYMPQWGHFTYSYICKDDIFH
EVEWFRNSTIYQIFPDRFAKFPPDTENSGKRTIHGGNIKGIIDRFDHLVKLGVDVVYLNP
IFKSESYHRYDVVDYYEIDPMFGSKEELRELMDLCHKNGIKVIFDGVFNHSGDKFFAFRD
VVEKGEKSKYANWYFINSFPVQGYPRPNYECFSFYGGMPKLNTGNPETAKYFLDVVKYWT
VEFGVDGWRLDAADEVDRKFWRKLRDMLKDLNKDVVLIGEIFDEASSWLWGDQFDSVINY
PLKAMINDLFAYRSIDVETFRNRISGYIMKFNKKVLSSLVNIISTHDTPRFLTLCNGDEK
RFEMAVVFQFTFPGVPLIYYGDEIGMEGEGDPDCRRPMIWDEAKWNKKTLELYKFLIGLR
KRFDALRTGEYGELPVTGCNGILAYRRGRGENGIIVAMNTLDRKENVVVETGDSFDTVKA
FESLKDEERLNVDKKRINICLNPFEWRIYKACGEL
Download sequence
Identical sequences A3DDK1
gi|125973313|ref|YP_001037223.1| WP_011837902.1.31213 203119.Cthe_0795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]