SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011837904.1.6636 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011837904.1.6636
Domain Number 1 Region: 11-224
Classification Level Classification E-value
Superfamily SGNH hydrolase 6.11e-34
Family Acetylhydrolase 0.012
Further Details:      
 
Domain Number 2 Region: 246-440
Classification Level Classification E-value
Superfamily SGNH hydrolase 3.36e-32
Family Acetylhydrolase 0.0087
Further Details:      
 
Domain Number 3 Region: 467-527
Classification Level Classification E-value
Superfamily Type I dockerin domain 6.38e-16
Family Type I dockerin domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011837904.1.6636
Sequence length 528
Comment lipase [Ruminiclostridium thermocellum]; AA=GCF_001692755.1; RF=na; TAX=572545; STAX=1515; NAME=Ruminiclostridium thermocellum DSM 2360; strain=LQRI; AL=Complete Genome; RT=Major
Sequence
MYKSKNLAAKVLSTLLIFITVISLINMEAPAASKTIKIMPVGDSCTEGMGGGEMGSYRTE
LYRLLTQAGLSIDFVGSQRSGPSSLPDKDHEGHSGWTIPQIASNINNWLNTHNPDVVFLW
IGGNDLLLNGNLNATGLSNLIDQIFTVKPNVTLFVADYYPWPEAIKQYNAVIPGIVQQKA
NAGKKVYFVKLSEIQFDRNTDISWDGLHLSEIGYKKIANIWYKYTIDILRALAGETQPNP
SPSSTPNTTKTIKIMPVGDSCTEGMGGGEMGSYRTELYRLLTQAGLSIDFVGSQRSGPSS
LPDKDHEGHSGWTIPQIASNINNWLNTHNPDVVFLWIGGNDLLLSGNVNATGLSNLIDQI
FTVKPNVTLFVADYYPWPEAVKQYNAVIPGIVQQKANAGKKVYFVKLSEIQFDRNTDISW
DGLHLSEIGYTKIANIWYKYTIDILKALAGQTQPTPSPSPTPTDSPLVKKGDVNLDGQVN
STDFSLLKRYILKVVDINSINVTNADMNNDGNINSTDISILKRILLRN
Download sequence
Identical sequences A3DDK4
203119.Cthe_0798 WP_011837904.1.19387 WP_011837904.1.20586 WP_011837904.1.31213 WP_011837904.1.6636 gi|385778772|ref|YP_005687937.1| gi|125973316|ref|YP_001037226.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]