SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011838039.1.31213 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011838039.1.31213
Domain Number 1 Region: 37-189
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 5.23e-38
Family Cellulose-binding domain family III 0.000063
Further Details:      
 
Domain Number 2 Region: 232-391
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.08e-34
Family CBM4/9 0.0036
Further Details:      
 
Domain Number 3 Region: 726-825,858-927
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000000241
Family Integrin A (or I) domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011838039.1.31213
Sequence length 1050
Comment carbohydrate-binding protein [Ruminiclostridium thermocellum]; AA=GCF_000015865.1; RF=representative genome; TAX=203119; STAX=1515; NAME=Ruminiclostridium thermocellum ATCC 27405; strain=ATCC 27405; AL=Complete Genome; RT=Major
Sequence
MLRRLSYKQSALLIAVCILIQIISLASFGLNVYANSANISLEFYNGDFGASVSSISMNFR
ITNNGSSQISLSDIKLRYYFTDDGVSPITVFIDYANNNGRGINNDVTYTIKDINSSGANK
YIEFGFNAQAGSLEPNTSVLMRARAYQSEYKQSFTQTNDYSFCQSNNDFAAWNKVTGYLN
GVLFSGTEPVMYSPTPSLSTPTPQISPTPVATPSSVPTYQATPTPSGFETPVNWDGKAVP
NGDFESGSVFWSFYCDSLSGANATNLIHSEPSGNKMSKTSITNAGSNHWAIQLKHDGIVL
ENLKTYRLTFDAKSTVPRNIRVSLQNATSSMIEYFGKIVEVEPKMKTYTCEFTFNSTTGT
NVAIVFEMGKIGTETDKAHDIVLDNVHIEKIASPSVSPVPSEDPQGAGITASRSSVYEAE
LGEEVDITLSQSGEIALEGRMDTEKEIVLVLDNSGVLNSYVEDILSPLDFGIYSNHNLTV
QGKDASINGSVHANDVFTSTADSISISQTCSAASFHITSKNVNINEYKNITIPIEMPNFH
SKLIDDAMRNSMVFRPEDYFLSWFPQPMPGQEDIFIFYNLIAGRFEIFGAGTLVINSSMY
FMGNVLISLTNTNNVGEGFIVADGNIIIQGQNLYPNGPNDKLYVYSIGGNIEFQTSNSTI
NGIVYAPGNPANPNSGKIFFSGDKNTINGSIAANELDFFAGGLVVNHTEGQFDTVEEKYI
DKSTYLKLVKDAAKNFVDKFAGSKTKMAVIQYSDSANDNDFKKYDLSLPDKGAALKETID
KIKPGTSGLSNMGDGMRRAYHILNGPPPKGQISKYIVVITGSVPNRWTAVDNKKNEPKTD
NGRADFIKADNESYNSLDYAKDMGRIITSKGINLVFIDFSEEDIGDVLEEIAAESGAKPL
EGTDRHYYKANNFLELLDILNNMTLKIYYDVVLDKVLYEEILPQGVLLVEAPEWISTESV
PMGGVNRIKLTGEINNIPFTFTGTGYSFVVESFKIKVKFLKPGTIVFDGADSRLRYNFNY
VDGAGNIHSKSVDKHFDDMTVNVTMKVDIN
Download sequence
Identical sequences A3DEW0
WP_011838039.1.31213 203119.Cthe_1257 gi|125973772|ref|YP_001037682.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]