SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011838381.1.69113 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011838381.1.69113
Domain Number 1 Region: 1-96,150-193,247-278,648-771
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.72e-26
Family ABC transporter ATPase domain-like 0.0079
Further Details:      
 
Domain Number 2 Region: 363-459
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.00000000000811
Family Rad50 coiled-coil Zn hook 0.0023
Further Details:      
 
Weak hits

Sequence:  WP_011838381.1.69113
Domain Number - Region: 192-401
Classification Level Classification E-value
Superfamily Tropomyosin 0.00196
Family Tropomyosin 0.0019
Further Details:      
 
Domain Number - Region: 555-596
Classification Level Classification E-value
Superfamily Prefoldin 0.0497
Family Prefoldin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011838381.1.69113
Sequence length 832
Comment chromosome segregation protein SMC [Staphylothermus marinus]; AA=GCF_000015945.1; RF=na; TAX=399550; STAX=2280; NAME=Staphylothermus marinus F1; strain=F1; AL=Complete Genome; RT=Major
Sequence
MIILGLRLKNIRSYIDKTIVFPRQGITVIYGDVGTGKSTILSSIAYALFGQPKSKIPDPM
ERYAYPKGEDLLRIGTREGYVRLLIQQKNRIILVERRLIKRSEGKVSDPGGRLVVFEYVE
ENGEQKLKLIHDRYYSSEELKRRVLKELGIPEIISKQKPLIFTNAIYVPQFSVNDIINLG
DNERILLINKALNIDKYNNIKTNLSKLTSQILNSEIKNLRNYEQRLESILGKNSIEELEK
KIKEAEKEINNINMAIQQVDESIRKLENEIKNYQQQYEKKQEERNNIKQKLAVIKHSLEE
LRAKEDNIKQLTSLLGLNEPIQLDVLSSKIKSQLEEIDKQLKNIDQRKQELQKKIEENRH
LSETINAEINKYREKIGELKAKINSKNEMLSEKQKELLEKEELLKKGICPLCKQKIAHEH
GYKLINSLKNEIETIKKEILEIQQLLRTALEELKKYEDKNLEINNEIKRLDEQLRIIDKE
RDKLINEKMELNDKLSKLTEIKRLCDEIEKLKQKIRDKDLLEKQLVHIETSISELKKIID
EETRKYKLLMNKKTDLIGKREKVKAEIESYKQQIQQLKEYYEEYQKTKEQRMFLENMKKF
LYGERNRRGLFYDLVEKVEERVRSIAYDKFRSLFINYFLKLMEDHEILDVDLDEKFSPVF
RIKTKRIIGEITQPSGGQLTSVSLAYRLALNAVARSMTPQLRNSTLILDEPTYGFSPERV
EKLRELLYEISNRGKRQIIVVTHDRNLLDVGDCRIKLDINRENNETIVNYEECNNLSKEY
YTYIENILSKGYTSILTTREAEEKEEKLVGGFEPKFKSRKVSKSRSIFDFLA
Download sequence
Identical sequences A3DKN0
399550.Smar_0077 WP_011838381.1.69113 gi|126464989|ref|YP_001040098.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]