SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011838772.1.69113 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011838772.1.69113
Domain Number - Region: 17-110
Classification Level Classification E-value
Superfamily Prefoldin 0.000654
Family Prefoldin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011838772.1.69113
Sequence length 140
Comment hypothetical protein [Staphylothermus marinus]; AA=GCF_000015945.1; RF=na; TAX=399550; STAX=2280; NAME=Staphylothermus marinus F1; strain=F1; AL=Complete Genome; RT=Major
Sequence
MSAVVKEFSSFADLIKNIDEELNTLKQQLADYLRRLEDIRAKSEQERRLRELLKNLTGEE
QTSKGKVVDLKDVKLYVNPDAEQEATVMEEIIDRINKTIQSLQSIRKALEPLSNVEVEAK
IVVVYKEGVPSSIILKLSSM
Download sequence
Identical sequences A3DLS1
399550.Smar_0472 gi|126465380|ref|YP_001040489.1| WP_011838772.1.69113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]