SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011878279.1.64742 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011878279.1.64742
Domain Number 1 Region: 6-145
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.27e-51
Family Ribonuclease PH domain 1-like 0.0000106
Further Details:      
 
Domain Number 2 Region: 309-498
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.66e-48
Family Ribonuclease PH domain 1-like 0.00000706
Further Details:      
 
Domain Number 3 Region: 460-558
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.94e-28
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 4 Region: 139-226
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.14e-25
Family Ribonuclease PH domain 2-like 0.0026
Further Details:      
 
Domain Number 5 Region: 566-650
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.09e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 
Domain Number 6 Region: 234-336
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 9.55e-19
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0029
Further Details:      
 
Domain Number 7 Region: 630-711
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.8e-16
Family Cold shock DNA-binding domain-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011878279.1.64742
Sequence length 740
Comment polyribonucleotide nucleotidyltransferase [Desulfotomaculum reducens]; AA=GCF_000016165.1; RF=representative genome; TAX=349161; STAX=59610; NAME=Desulfotomaculum reducens MI-1; strain=MI-1; AL=Complete Genome; RT=Major
Sequence
MSENQVLIREISLGGRTLTLETGRMAKQASGAVLVTYGETVVLVTATVAKNTRDIDFFPL
TVDYEERLYAVGKIPGGFIKREGRPSEKAILSGRLIDRPIRPLFPKHMRNEVQVVATVMS
VDQDNAPEIAAMIGASAALHISKIPLKKPIGGVIVGRVDGQFVINPMVRQAENSDMHLVV
AGTDDAVMMVEAGAKEVPESEMLEGIMYGHEKVKEIVKFIEDFRTEALGMGLAFEKMEIP
EPQFDSNMSEAILTIAEEAIREAVLHCSREKLTKKQREVYMDEVMSGLQEKFLEQFPENP
KEVTMLIEKAEKKVVRRIITHDKLRIDGRAIDEIRPISVEVGVLPRTHGTGLFTRGQTQI
LSVATLGSISEEQILDGLGVEESKRYMHHYNFPPFSTGETKPMRSPGRREIGHGALAERA
LEPMIPPEEVFPYTIRVVSEAIESNGSTSMGSVCGSTLSLMDAGVPLKAPVAGVAMGLIM
EEDQFTVLTDIQGLEDHLGDMDFKVAGSANGVTALQMDIKIPGITREVFEQALEQAHRGR
MFILGKMLEVLSTPRAEISVHAPAIIRTSIHPDKIRDIIGPGGKIIKKLVEETGADIDIE
DDGRVFIAAVDREKGKRALEIIQSITAEVQVGKLYNGKVTRVTDFGCFVEVIPGVMGLPG
KEGLVHISQLAFQRVEKTEDIVKEGEVIAVKAIGYDQQGRLKLSKKEAMRDMGLAPAEST
SEQPEKRERRPFSRPKATKE
Download sequence
Identical sequences A4J5W6
gi|134299798|ref|YP_001113294.1| 349161.Dred_1950 WP_011878279.1.64742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]