SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011903984.1.3277 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011903984.1.3277
Domain Number 1 Region: 85-302
Classification Level Classification E-value
Superfamily Prim-pol domain 9.81e-26
Family Bifunctional DNA primase/polymerase N-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011903984.1.3277
Sequence length 391
Comment DNA primase [Salinispora tropica]; AA=GCF_000016425.1; RF=representative genome; TAX=369723; STAX=168695; NAME=Salinispora tropica CNB-440; strain=CNB-440; AL=Complete Genome; RT=Major
Sequence
MTGGHWIGASKALGRFVSVDLPYPHICGRTVAAEDTVSGQPLQVARWEKVRYCAACAHDK
HLKAHPFTPDSRRPNPMRDATTLREVALAAALRGWHIFPLRPDDKRPAFPDHLADACTGR
DPRCRNGHTGWEARATTDPDRIRRGWSETPWGVGIACGPSGLVVIDLDVRKPDQDAPPGN
PHPAATSGIDVFAALCETAGQPIPDDTYAVTTGRGGSHLYFRHPADSPALRNTAGERGNG
LGWLVDTRAHGGYVVAAGSTVAGRSYTVARDLPVAELPGWLAERLAPAPLPPQRPVVVDL
PTGRTGAYLDAAITRQLDHLRRAAEGERNHTLYVSAVAFGQLAAGGALPADQAEALLEEA
ALSIGLSRFETLRTIRSGLTVGARRPRTVAA
Download sequence
Identical sequences A4X0Z7
gi|145592628|ref|YP_001156925.1| 369723.Strop_0062 WP_011903984.1.3277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]