SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011917650.1.70764 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011917650.1.70764
Domain Number 1 Region: 308-472
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.49e-29
Family HD domain 0.028
Further Details:      
 
Domain Number 2 Region: 208-304
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.34e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011917650.1.70764
Sequence length 521
Comment MULTISPECIES: ribonuclease Y [Caldicellulosiruptor]; AA=GCF_000404025.1; RF=na; TAX=1214564; STAX=1214564; NAME=Caldicellulosiruptor sp. F32; strain=F32; AL=Contig; RT=Major
Sequence
MQKISDTLKLIITAGVSIALAIVAFFLGYLYRKKIAEKTIKSAEQEAQRIVEEAKKQAEA
YKKEATLLAKEEIHRARSEFDREVRERRAELQRFERRLIQKEEMLDKKMAAVEEKEEQLN
QKIKDVQKLQEEIELLKQKQQEELQRISGLTQEEARQIILKSVEQDVKHDVALMIKELEQ
QAKEEADKKAREIIALAIQRYSSDYVAENTVSVVTLPNDEMKGRIIGREGRNIKTFETVT
GIDLIIDDTPEAVILSGFDPIRREIAKLTLEKLILDGRIHPARIEEMYEKAKREVENKIR
EEGERVVFELGIHNLHPELIKLIGKLRYRTSYGQNVLAHSIEVANIAGIMAAELGLDQSI
AKRAGLLHDIGKAVDHEVEGSHALIGYDLAKRYKETNPDVLEAIGGHHGEMETRSIYNVL
IQAADSVSAARPGARRESLESYIKRLQKLEEIANSFDGVEKAYAIQAGREIRIMVKPDHV
SDDDIVIMAREIVKRIESELDYPGQIKVNVIREVRAVEYAK
Download sequence
Identical sequences A4XLD4
351627.Csac_2136 WP_011917650.1.70764 WP_011917650.1.85531 ClR47 gi|146297139|ref|YP_001180910.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]