SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011918773.1.82224 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011918773.1.82224
Domain Number 1 Region: 3-66,103-150
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000301
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011918773.1.82224
Sequence length 153
Comment SMI1/KNR4 family protein [Shewanella putrefaciens]; AA=GCF_000016585.1; RF=na; TAX=319224; STAX=24; NAME=Shewanella putrefaciens CN-32; strain=CN-32; AL=Complete Genome; RT=Major
Sequence
MKILELQIERGIELPSDYLEFVAGIDAGEDYCFNEYPDEYHEFKGRCWAFFDEELLCENI
KMSGVGNAPAHRQLELYLKCYQEFSNSEFVHSSEGKLPINRVANGFVVAEENGDLLYLDP
EDNFSVWIFHHDGSDVKKVSNSMSEWLARTTNA
Download sequence
Identical sequences A4Y3W6
gi|146292024|ref|YP_001182448.1| 319224.Sputcn32_0920 WP_011918773.1.82224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]