SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011919947.1.82224 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011919947.1.82224
Domain Number 1 Region: 31-157
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000133
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011919947.1.82224
Sequence length 176
Comment SMI1/KNR4 family protein [Shewanella putrefaciens]; AA=GCF_000016585.1; RF=na; TAX=319224; STAX=24; NAME=Shewanella putrefaciens CN-32; strain=CN-32; AL=Complete Genome; RT=Major
Sequence
MTLSVLNSILVPPNIPNESGIGNVWPSIDEGLSFPSDYIAFINRYGTGRIADFIAIFNPF
TTNCDLDFFEQKKSIIEDFNYLNNEDPEYFKYNLYPEINGLLPIGVTDNGDCIFWVVSDL
KDSDTWGTAIIASRSPDVEYFDENITSLLSGLLLRKIRSGSLPNSFPPKNIAFEKI
Download sequence
Identical sequences A4YAD3
WP_011919947.1.82224 319224.Sputcn32_3204 gi|146294291|ref|YP_001184715.1| 2005424909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]