SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011921228.1.31166 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011921228.1.31166
Domain Number 1 Region: 7-113
Classification Level Classification E-value
Superfamily Prefoldin 1.15e-23
Family Prefoldin 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011921228.1.31166
Sequence length 128
Comment prefoldin subunit beta [Metallosphaera sedula]; AA=GCF_001266675.1; RF=na; TAX=43687; STAX=43687; NAME=Metallosphaera sedula; strain=ARS50-2; AL=Complete Genome; RT=Major
Sequence
MAERIPPELQTQLLKLQQLQSQLERLTYEKSVIEGELREVNEVLKELANIPQDSPVYKIV
GNLLIKQDRNNVQNELNERKELLELKSRTYQKQEGLLRKQFEDLQKKVNELIQKYYPQGA
PGASPPKA
Download sequence
Identical sequences A0A088E1T5 A4YCV7
399549.Msed_0082 WP_011921228.1.15515 WP_011921228.1.27320 WP_011921228.1.28583 WP_011921228.1.31166 WP_011921228.1.34633 WP_011921228.1.8883 WP_011921228.1.99084 gi|146302867|ref|YP_001190183.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]