SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011958626.1.23570 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011958626.1.23570
Domain Number 1 Region: 2-128
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 8.89e-32
Family Thiamin pyrophosphokinase, catalytic domain 0.0018
Further Details:      
 
Domain Number 2 Region: 148-209
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.00000000144
Family Thiamin pyrophosphokinase, substrate-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011958626.1.23570
Sequence length 221
Comment thiamine pyrophosphokinase [Roseiflexus sp. RS-1]; AA=GCF_000016665.1; RF=na; TAX=357808; STAX=357808; NAME=Roseiflexus sp. RS-1; strain=RS-1; AL=Complete Genome; RT=Major
Sequence
MYVVIVANAPSLSLDPYRSLITDADVVIAADGGANALVEAHLRPSLVIGDLDSLDDARLA
ALAADGVELRRFPREKDETDLELALLHAAAIGAERIDVLGALGGRWDHTFANVAMLAMPE
LCGRQVRLIDERQRLFLVRDQATLDGSPGDTLSLLPLTPVVHGITTRGLFYALHDATLHF
ERARGVSNILIDPPGFVSLREGLLLVVQHDDRGALQWNVGR
Download sequence
Identical sequences A5V083
gi|148658031|ref|YP_001278236.1| 357808.RoseRS_3933 WP_011958626.1.23570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]