SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011960943.1.63326 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011960943.1.63326
Domain Number 1 Region: 29-233
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 8.78e-27
Family Bacterial lipase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011960943.1.63326
Sequence length 249
Comment hypothetical protein [Psychrobacter sp. PRwf-1]; AA=GCF_000016885.1; RF=na; TAX=349106; STAX=349106; NAME=Psychrobacter sp. PRwf-1; strain=PRwf-1; AL=Complete Genome; RT=Major
Sequence
MLKLPLPNIVPLKKPDKPHKLSHKLMTHGDSERPFVVLIHGLHQKDWIMTPLAKQLQNRG
FATHQHNYHSLRERIDQHSKRLNQWLTEHHNPAIAIHLVGHSLGGLVIRDFVARYPHWKI
GRCVTLGTPHNGSTTAKYMSTLAAPLVGHSFKNALDGQSAPWPKSISLGVIAGDAPYGLG
QLVLNYHNQKVNLSQPQSAHDGTVYVFETQLNEATDHIIMPVSHTGMLINPKVAEQTAYF
LDHGYFKRR
Download sequence
Identical sequences A5WG75
gi|148653523|ref|YP_001280616.1| WP_011960943.1.63326 349106.PsycPRwf_1726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]