SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011981851.1.7041 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011981851.1.7041
Domain Number 1 Region: 83-216
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.15e-22
Family GntR ligand-binding domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 11-81
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.21e-16
Family GntR-like transcriptional regulators 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011981851.1.7041
Sequence length 218
Comment GntR family transcriptional regulator [Kineococcus radiotolerans]; AA=GCF_000017305.1; RF=representative genome; TAX=266940; STAX=131568; NAME=Kineococcus radiotolerans SRS30216 = ATCC BAA-149; strain=SRS30216; AL=Complete Genome; RT=Major
Sequence
MDTASPSRTGSPPPAADRVYAEVKHGILDRSLPGGLLLTEGEIADRVGVSRTPVREGLLK
LQAEGLVHLIPKRGALVVPVSPAEVEDVLETRELVEVHTAARAWEHRGELAEALRPHLEA
MRAAVDDPWAFMHADRTFHAAVVRSAGNEVLAGIYDSLRDRQMRMGVANVHGSSDRIATA
LADHERLREALLGEDREDWLALVRDHVRRAGDRLRAVR
Download sequence
Identical sequences A6W871
266940.Krad_1522 WP_011981851.1.7041 gi|152965490|ref|YP_001361274.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]