SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011984589.1.20576 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011984589.1.20576
Domain Number 1 Region: 8-108
Classification Level Classification E-value
Superfamily RmlC-like cupins 6.61e-19
Family EutQ-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011984589.1.20576
Sequence length 118
Comment cupin [Anaeromyxobacter sp. Fw109-5]; AA=GCF_000017505.1; RF=na; TAX=404589; STAX=404589; NAME=Anaeromyxobacter sp. Fw109-5; strain=Fw109-5; AL=Complete Genome; RT=Major
Sequence
MARLVTTPFVVPAAGNPPKLIEELFGRVATGSAGVSVARMTSPPGWAEPGQTPEFDEYTV
VLEGALRVETREGVLEVGAGQAVHAPSGEWVRYSTPAGARYLAVCVPAFSLDTVHRDG
Download sequence
Identical sequences A7H6Y7
WP_011984589.1.20576 gi|153003142|ref|YP_001377467.1| 404589.Anae109_0265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]