SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011989781.1.67127 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011989781.1.67127
Domain Number 1 Region: 312-507
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.61e-46
Family Ribonuclease PH domain 1-like 0.0000465
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.47e-37
Family Ribonuclease PH domain 1-like 0.00013
Further Details:      
 
Domain Number 3 Region: 470-564
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.57e-26
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 140-250
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.33e-21
Family Ribonuclease PH domain 2-like 0.0038
Further Details:      
 
Domain Number 5 Region: 575-675
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000497
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 
Domain Number 6 Region: 647-714
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000647
Family Cold shock DNA-binding domain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011989781.1.67127
Sequence length 718
Comment polyribonucleotide nucleotidyltransferase [Campylobacter jejuni]; AA=GCF_000017485.1; RF=na; TAX=360109; STAX=197; NAME=Campylobacter jejuni subsp. doylei 269.97; strain=269.97; AL=Complete Genome; RT=Major
Sequence
MQYSIEINKNTEIFDIDKVAKQATGVLMRQGKSVVLATVAREEKQVEEDFLPLTVQYIEK
AYAAGKIPGGYVKRETKPSDAETLTARIIDRSLRPLFPKGYAYPTQIVVMVLSADPKVDL
QVMSLNAASVALYLSDIPMKAPVCGVRIGKIDGNFILNPNNEELQNSTLDLYVAGVKDEL
LMIEMRALPDQKENEIFIEAPYADVLTQTTSQNMNELSEDEILEALNLAQKAILNGSNAY
EEAFSKHKKNSQIELKNEIEHPEILAFIENNFQKQIKKAINQMAKSERASELNKIAKEIL
NLEIAKDWSEESILNTLAKVKRKLIREQILNEGKRADGRSLNEVRPISIETNILPNAHGS
CLFTRGQTQALVVATLGGENDAQMIDLLTEKNPISERFMVNYNFPGFSVGEASPIKAPGR
RELGHGNLAKRALYPSVDENYPYVIRLVSEILESNGSSSMATVCGGSLALKAAGVPSLKL
VAGVAMGLIFEDNKYAVLTDIMGLEDHDGDMDFKVAGSKDGITALQMDIKLGGIDQETLK
QALYQAKEGRIHILNIMEEATKEIIVNEEVLPKLELFSVDPSKIVDIIGQAGKTIKEIIE
KFGVSIDLDREKGEVKIAGSQNEQIKAAKDYIINITSSQKGTKKGSKDKDISDFELGQEF
QGIVKKIAPFGAFVELKNGVDGLLHSSKIKHLDLSENQSLKVKISEIKNGKISVDLCE
Download sequence
Identical sequences A7H2C7
gi|153951894|ref|YP_001397657.1| 360109.JJD26997_0472 WP_011989781.1.67127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]