SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011997025.1.29693 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011997025.1.29693
Domain Number - Region: 319-392
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0418
Family Pseudo ankyrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011997025.1.29693
Sequence length 734
Comment hypothetical protein [Coxiella burnetii]; AA=GCF_000017105.1; RF=na; TAX=434922; STAX=777; NAME=Coxiella burnetii Dugway 5J108-111; strain=Dugway 5J108-111; AL=Complete Genome; RT=Major
Sequence
MRRKKESSERLSKRNKVPVTLKELRARLSELEQWIAQEKKLVDFPNIWSFLEGKVEEGEW
EGVNGFWLMVYEGLRGKATLLEALAVYLEGPAKNDINASHLKASPRGEDREAGENVLCLI
ACAAGKRHPAMLNALVDQVKDLPSEDLLLLLKETAKGRNVAGVNTLWLIACAAVKGHPAM
LNALADRIKELSIEHLPLLLKETAQEAEGARRNTLWVIACAASHGHSAMLNALSDGVKKL
SAQDLLLLLKETAQAGGATGQNTLWEIACAAVNGHAAMLNALAGRIKELSKELSIEKLWL
LLKETAQAGGDAGRNTLWLIAWAAVKGHPAMLNALADRIKELSIENLLLLLEETAQAGDA
TGHNTLWLIAWAAVKGHPAMLNALVMHIKNLKPEEISDLLQKRPEGGVMAGENGLRLIVK
VAQSGHVEMLNAVAKKLMQLPRDKRSKLLTPEPENSTFEMLISVAARELKTQEFELLLPD
CFTDQFDLPASEDNYMQKIFPLMKEVNELISTPQASVESLEENEEPTVINPVDKQKLEFI
LDQVTQIETTKAKTNLLSFILFKLQHRINPTFMIKILVPLIRTEPKYSNNPQIKQLYLEN
KFSIITNIKNKRHEIESHLLDAFKVLKLGEESLDESLYSTLDHFIMQVFNYNQIGLDIDQ
AEKIRSHILAHCDQNVTALPYEIFTGMVITKAKDFLKTNSAPQRATRFGMFSLSGKQTEE
WLRDHDFSGEFELN
Download sequence
Identical sequences A9KFR4
WP_011997025.1.29693 WP_011997025.1.43615 WP_011997025.1.99156 434922.CBUD_1299 gi|154707205|ref|YP_001424653.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]