SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011998247.1.33635 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011998247.1.33635
Domain Number 1 Region: 64-155
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.55e-20
Family Cold shock DNA-binding domain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 151-230
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.33e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00012
Further Details:      
 
Domain Number 3 Region: 9-63
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0000000011
Family ECR1 N-terminal domain-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011998247.1.33635
Sequence length 239
Comment RNA-binding protein [Ignicoccus hospitalis]; AA=GCF_000017945.1; RF=representative genome; TAX=453591; STAX=160233; NAME=Ignicoccus hospitalis KIN4/I; strain=KIN4/I; AL=Complete Genome; RT=Major
Sequence
MNKQSNEVQRKIVMPGDLVVKGNYTINPKSIMYLYKVGDAVYAAVAGMAEITNGTVSLIP
FEGTYIPKPGDLVIGVVENFVVTHWQVDINSPYIGILHVSNLLGRPYNPAKDNLKEYLDI
GDYIIAKVESFDRTKDPILNVQGKGLGRVVEGKIVEIKPSRVPRVIGKKKSMLNVIKGDT
GCEIIVGANGRIWIKCPNKDLEDIVTLAIKLIEREAFATGLTEKVRVLIATEKHERGLL
Download sequence
Identical sequences A8A8Z3
gi|156937006|ref|YP_001434802.1| 453591.Igni_0211 WP_011998247.1.33635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]