SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011998352.1.33635 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011998352.1.33635
Domain Number - Region: 60-118
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000524
Family GHMP Kinase, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011998352.1.33635
Sequence length 255
Comment GHMP kinase [Ignicoccus hospitalis]; AA=GCF_000017945.1; RF=representative genome; TAX=453591; STAX=160233; NAME=Ignicoccus hospitalis KIN4/I; strain=KIN4/I; AL=Complete Genome; RT=Major
Sequence
MIVEVPLHVSGLWRPVWRRSAISTGSLGAGVLLKPGAVCSPGGPRPPVPTALGEVRCKLP
VPVGKGFATSAAIALASAIFKYKSFVEAAARAHVAEVLNKTGLGDVMAIAYGRGVAVRTE
AGGPGWGRVESLEVPRKVFVVGFTVKGLFADTPSMLSSLDVREAFEDAWKALLDGFDFYS
FLEAAEAFSARVGFLKFVEPRLLKLPGVMGGYVKKSAGVLFVEGAYADEVLEEVKKVYKV
ARAFTPASFYMRVAP
Download sequence
Identical sequences A8A998
453591.Igni_0317 gi|156937111|ref|YP_001434907.1| WP_011998352.1.33635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]