SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012011068.1.28396 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012011068.1.28396
Domain Number 1 Region: 325-359,392-661
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 1.7e-67
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000163
Further Details:      
 
Domain Number 2 Region: 95-195
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00000000126
Family Sensory domain of two-component sensor kinase 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012011068.1.28396
Sequence length 663
Comment chemotaxis protein [Bacillus pumilus]; AA=GCF_000017885.4; RF=na; TAX=315750; STAX=1408; NAME=Bacillus pumilus SAFR-032; strain=SAFR-032; AL=Complete Genome; RT=Major
Sequence
MKNALKWLKKPSISKRLIISFTLVLVLPIITLSTISYQIAKEELDHEIMYGANARVNELN
DMIQQKLVNKENAVKLFTETSSAADFKKNNQDELYEHFEIYSKINDEDVVGFYAASKKRD
FIQFPKVDMPKGYDPTTRDWYQLAMQDDSGNPVVTNPYISATTNGMVVTIAQRLKDGSGA
IGIDIDVQDIVDKIKEIKIGREGYPIIANKNKQIVAHPEEKSGSKVTENISSILYSGKEG
TSTYENKGEQKRLVFVTNDLTGWKIAGTMFVSETEEAAQPVWNSAIILLISSFILGGIAI
FFIVRSITIGLRKLVDFSEKVSEGDLTETLETKSKDEIGDLTRSFSKMSESLRDVIRAVQ
QSVDNVASASEELTASASQTSQATEHITMSIEQFSNGNDAQNEKVESSTNQLVAMNEGLQ
GMSQTSSEVASVSLQSTEAAGQGGRIVESTASQMKHIDTSVQEAEQVMKQLEFKSKDITS
ILNVINGIADQTNLLALNAAIEAARAGESGRGFSVVAEEVRKLAVQSADSAKEIEKLIQE
IVLEIAKSQDMFKTVNREVHAGLGMTEEAKESFQNIYEAAEGMSKKLTQLNDTAIDLSSG
SKLVSQAMQEMRQVSRESAANIQDIAASAEEQLASMEEISSSSVTLANMAEELKELTSQF
KID
Download sequence
Identical sequences A8FGS8
315750.BPUM_2790 gi|157693543|ref|YP_001488005.1| WP_012011068.1.28396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]