SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012021338.1.99084 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012021338.1.99084
Domain Number 1 Region: 3-46,139-319
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.99e-21
Family Glutaminyl-peptide cyclotransferase-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012021338.1.99084
Sequence length 361
Comment Zn-dependent exopeptidase M28 [Metallosphaera sedula]; AA=GCF_000747605.1; RF=na; TAX=43687; STAX=43687; NAME=Metallosphaera sedula; strain=CuR1; AL=Chromosome; RT=Major
Sequence
MELARQLFNLGEAIHGGPEELKILEKLEELFPDYESIPVNTKFWDVRFSEILANGQNIPS
VAMPYTSGCVKGRVGREIGLFPMPSHPFDLKNLPLSQYEGVIIVEEGKLRRITLPQGSPP
TFFASRNVDGYVELCSDTRLVEANSRNLEITLREGDSYILLGAHVDHWLSGFHDNILSVQ
LLVDMKKDLERSNLRHGVKLVFFSSEEGPRCCTGSSQFPVKDAFAVISLDAIYPSRVVFS
GTPDLWFLSKHFPLKRVEMPTPFSDHYPFVQRGIPGLVLYNDDMTTVYHSDADVPTPLDP
QYLEVLRKSLVEALRELDSTPSDRLDEEFFRHAKLAGYTGDTREGALIPDPSTLTTKFKR
I
Download sequence
Identical sequences A0A088E885 A4YGJ9
WP_012021338.1.15515 WP_012021338.1.27320 WP_012021338.1.28583 WP_012021338.1.31166 WP_012021338.1.34633 WP_012021338.1.8883 WP_012021338.1.99084 gi|146304159|ref|YP_001191475.1| 399549.Msed_1393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]