SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012021572.1.8883 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012021572.1.8883
Domain Number 1 Region: 11-142
Classification Level Classification E-value
Superfamily Prefoldin 8.37e-17
Family Prefoldin 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012021572.1.8883
Sequence length 144
Comment prefoldin subunit alpha [Metallosphaera sedula]; AA=GCF_000016605.1; RF=representative genome; TAX=399549; STAX=43687; NAME=Metallosphaera sedula DSM 5348; strain=DSM 5348; AL=Complete Genome; RT=Major
Sequence
MAESNNRMVVSLEDLLAQADALRKEIDALQKLRDEIAESLNAARSAKEAINLIKGQGKDL
LLSADRRGFVLLKVTEIPSSKVLVNLGLGYYAEIEPDQASKILDEREEQLNKSLQDITAR
LNNAVNAYTQIAEILNRAQQQQGE
Download sequence
Identical sequences A0A088E5M7 A4YH83
gi|146304393|ref|YP_001191709.1| WP_012021572.1.15515 WP_012021572.1.27320 WP_012021572.1.28583 WP_012021572.1.31166 WP_012021572.1.34633 WP_012021572.1.8883 WP_012021572.1.99084 399549.Msed_1630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]