SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012021823.1.34633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012021823.1.34633
Domain Number 1 Region: 14-150
Classification Level Classification E-value
Superfamily Nqo5-like 4.32e-39
Family Nqo5-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012021823.1.34633
Sequence length 160
Comment NADH-quinone oxidoreductase subunit C [Metallosphaera sedula]; AA=GCF_001266715.1; RF=na; TAX=43687; STAX=43687; NAME=Metallosphaera sedula; strain=ARS120-2; AL=Complete Genome; RT=Major
Sequence
MSEKPIDLVVKLLQERKIPLKVEGDTRGSIEVDKSKLVETAKVLKELGFDHVKAVTGIDY
PDQAKFQVVYHVSSFDLQLSKVIIALKTWTSYKEPVVPSLLSVWGSVWTGERETYEMLGI
TFEGNPDMRRLFLPEDFEGVYPLRKSFKVKTEGLFVDKSS
Download sequence
Identical sequences A0A088E9M7 A4YHY4
399549.Msed_1896 WP_012021823.1.15515 WP_012021823.1.27320 WP_012021823.1.28583 WP_012021823.1.31166 WP_012021823.1.34633 WP_012021823.1.8883 WP_012021823.1.99084 gi|146304644|ref|YP_001191960.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]