SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012022068.1.28583 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012022068.1.28583
Domain Number 1 Region: 8-137
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.59e-32
Family Translational machinery components 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012022068.1.28583
Sequence length 137
Comment 30S ribosomal protein S9 [Metallosphaera sedula]; AA=GCF_001266735.1; RF=na; TAX=43687; STAX=43687; NAME=Metallosphaera sedula; strain=SARC-M1; AL=Complete Genome; RT=Major
Sequence
MSTESRVIITNSRRKMARAKCYLFPGKGRIFVNDVPIELIPVEVIRMKIMEPMLLAGEGI
TSKVDVKIYTYGGGIMGQADAARMALARALVRFTGSQELKELYKKYDRTMMAGDPRQTEA
EKWMRYSARRWRQKSYR
Download sequence
Identical sequences A0A088E735 A4YIM9
WP_012022068.1.15515 WP_012022068.1.27320 WP_012022068.1.28583 WP_012022068.1.31166 WP_012022068.1.34633 WP_012022068.1.8883 WP_012022068.1.99084 gi|146304889|ref|YP_001192205.1| 399549.Msed_2142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]